PDB entry 1q3c

View 1q3c on RCSB PDB site
Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli: The E2A mutant at 2.3 resolution.
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-07-29, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease VIII
    Species: Escherichia coli [TaxId:562]
    Gene: nei
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50465 (Start-261)
      • engineered (1)
      • see remark 999 (33)
      • see remark 999 (111)
    Domains in SCOPe 2.08: d1q3ca1, d1q3ca2, d1q3ca3
  • Heterogens: ZN, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3cA (A:)
    pagpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
    dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
    flqrvgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgl
    tgnhkakdlnaaqldalahalleiprfsyatrgqvdenkhhgalfrfkvfhrdgepcerc
    gsiiekttlssrpfywcpgcqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3cA (A:)
    agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
    ltlyshnqlygvwrvvdtgettrvlrvklqtadktillysasdiemlrpeqltthpflqr
    vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
    kakdlnaaqldalahalleiprfsyatrgenkhhgalfrfkvfhrdgepcercgsiiekt
    pfywcpgcqh