PDB entry 1q38

View 1q38 on RCSB PDB site
Description: Anastellin
Class: cell adhesion
Keywords: amyloid fibril, anastellin, extracellular matrix, fibronectin type 3 (FN3) domain, dynamic fluctuations, conformational exchange, CHAPS, CELL ADHESION
Deposited on 2003-07-28, released 2003-11-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1 OR FN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (4-78)
    • cloning artifact (0-3)
    • cloning artifact (79-88)
  Domains in SCOPe 2.04: d1q38a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q38A (A:)
  mrgsnapqpshiskyilrwrpknsvgrwkeatipghlnsytikglkpgvvyegqlisiqq
  yghqevtrfdftttststpgsrshhhhhh