PDB entry 1q2q

View 1q2q on RCSB PDB site
Description: Enterobacter cloacae GC1 class C beta-lactamase complexed with penem WAY185229
Class: hydrolase
Keywords: hydrolase, inhibition, beta-lactam antibiotics, drug design
Deposited on 2003-07-25, released 2004-09-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.145
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class C beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: bla
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q2qa_
  • Heterogens: WY2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q2qA (A:)
    pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvmanm
    apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
    aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
    alq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q2qA (A:)
    pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavravrmldaqaygvktnvqdmanwvmanmapen
    vadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaevn
    ppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq