PDB entry 1q10

View 1q10 on RCSB PDB site
Description: Ensemble of 40 Structures of the Dimeric Mutant of the B1 Domain of Streptococcal Protein G
Class: protein binding
Keywords: GB1, core mutants, NMR structure, domain-swapping, oligomerization
Deposited on 2003-07-18, released 2003-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-14, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. group G
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOP 1.73: d1q10a_
  • Chain 'B':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. group G
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOP 1.73: d1q10b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q10A (A:)
    mqykvilngktlkgettteavdaataekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q10B (B:)
    mqykvilngktlkgettteavdaataekvvkqffndngvdgewtyddatktftvte