PDB entry 1q0x

View 1q0x on RCSB PDB site
Description: Anti-morphine Antibody 9B1 Unliganded Form
Deposited on 2003-07-17, released 2004-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q0xH (H:)
    evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
    nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvssa
    sttppsvyplapgghhhhhhsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaa
    dlytlsssvtvsasswpgqsvtcnvahpasstkvdkkiaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0xH (H:)
    evqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgdtif
    nekfkgkatftadtssntaymqlssltsedsavyycarwvldyygmdywgqgtsltvssa
    sttppsvyplapggsamvtlgclvkgyfpepvtvvwnkgslstgthtfpavlaadlytls
    ssvtvsasswpgqsvtcnvahpasstkvdkkiaps
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0xL (L:)
    davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlgqpkssptvtl
    fppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghssnktlsra