PDB entry 1q0w

View 1q0w on RCSB PDB site
Description: Solution structure of Vps27 amino-terminal UIM-ubiquitin complex
Class: transport protein
Keywords: protein-protein complex
Deposited on 2003-07-17, released 2003-10-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-07, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein VPS27
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40343 (0-23)
      • engineered (0)
    Domains in SCOP 1.73: d1q0wa_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Saccharomyces cerevisiae
    Gene: (UBI1 OR RPL40A OR YIL148W) AND (UBI2 OR RPL40B OR YKR094C) AND (UBI3 OR RPS31 OR YLR167W OR L9470.14) AND (UBI4 OR SCD2 OR YLL039C)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q0wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0wA (A:)
    ypedeeelirkaielslkesrnsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0wB (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg