PDB entry 1pzy

View 1pzy on RCSB PDB site
Description: w314a-beta1,4-galactosyltransferase-I complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese
Class: transferase activator/transferase
Keywords: Beta1,4-Galactosyltransferase-I Tryptophan Mutant, Flexible loop Conformation, Protease Digetion, Substrate Binding, Catalytic Mechanism, TRANSFERASE ACTIVATOR-TRANSFERASE COMPLEX
Deposited on 2003-07-14, released 2003-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzya_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (197)
      • engineered (225)
    Domains in SCOPe 2.06: d1pzyb_
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzyc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (197)
      • engineered (225)
    Domains in SCOPe 2.06: d1pzyd_
  • Heterogens: NAG, CA, MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzyA (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzyB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgaggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzyB (B:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgaggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzyC (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pzyD (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgaggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzyD (D:)
    tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
    qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
    dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
    wgaggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketml
    sdglnsltymvlevqryplytkitvdigtps