PDB entry 1pzp

View 1pzp on RCSB PDB site
Description: TEM-1 Beta-Lactamase in Complex with a Novel, Core-Disrupting, Allosteric Inhibitor
Class: hydrolase
Keywords: beta-lactamase, novel allosteric inhibitor, core-disruption, crystal structure, HYDROLASE
Deposited on 2003-07-14, released 2004-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.203
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-260)
      • engineered (74)
    Domains in SCOPe 2.06: d1pzpa_
  • Heterogens: FTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pzpA (A:)
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqrdlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw