PDB entry 1pzj

View 1pzj on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Nitrophenyl Galactoside 5
Class: toxin
Keywords: pentamer, monovalent, toxin, inhibitor, cholera
Deposited on 2003-07-11, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CAA41591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57193 (0-102)
  Domains in SCOPe 2.08: d1pzjd_
• Chain 'E':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CAA41591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57193 (0-102)
  Domains in SCOPe 2.08: d1pzje_
• Chain 'F':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CAA41591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57193 (0-102)
  Domains in SCOPe 2.08: d1pzjf_
• Chain 'G':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CAA41591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57193 (0-102)
  Domains in SCOPe 2.08: d1pzjg_
• Chain 'H':
  Compound: cholera toxin b subunit
  Species: Vibrio cholerae [TaxId:666]
  Gene: CAA41591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57193 (0-102)
  Domains in SCOPe 2.08: d1pzjh_
• Heterogens: 15B, J15, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzjD (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzjE (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzjF (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzjG (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzjH (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman