PDB entry 1pzh

View 1pzh on RCSB PDB site
Description: T.gondii LDH1 ternary complex with NAD and oxalate
Class: oxidoreductase
Keywords: NADH-dependent dehydrogenase, tetramer, Rossmann fold, OXIDOREDUCTASE
Deposited on 2003-07-10, released 2004-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: lactate dehydrogenase (LDH1)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613 (Start-330)
      • cloning artifact (329-330)
    Domains in SCOPe 2.06: d1pzha1, d1pzha2, d1pzha3
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: lactate dehydrogenase (LDH1)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613 (Start-330)
      • cloning artifact (329-330)
    Domains in SCOPe 2.06: d1pzhb1, d1pzhb2, d1pzhb3
  • Chain 'C':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: lactate dehydrogenase (LDH1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzhc1, d1pzhc2
  • Chain 'D':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: lactate dehydrogenase (LDH1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzhd1, d1pzhd2
  • Heterogens: OXL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzhA (A:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzhA (A:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqapg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzhB (B:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzhB (B:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqapg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pzhC (C:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzhC (C:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pzhD (D:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzhD (D:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq