PDB entry 1pzf

View 1pzf on RCSB PDB site
Description: T.gondii LDH1 ternary complex with APAD+ and oxalate
Class: oxidoreductase
Keywords: APAD, Rossmann fold, tetramer, apicomplexa, OXIDOREDUCTASE
Deposited on 2003-07-10, released 2004-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613
      • cloning artifact (329)
    Domains in SCOPe 2.06: d1pzfa1, d1pzfa2, d1pzfa3
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613
      • cloning artifact (329)
    Domains in SCOPe 2.06: d1pzfb1, d1pzfb2, d1pzfb3
  • Chain 'C':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzfc1, d1pzfc2
  • Chain 'D':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzfd1, d1pzfd2
  • Heterogens: OXL, A3D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzfA (A:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzfA (A:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzfB (B:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzfB (B:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pzfC (C:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzfC (C:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pzfD (D:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzfD (D:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq