PDB entry 1pzb

View 1pzb on RCSB PDB site
Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Deposited on 1994-08-03, released 1994-11-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1pzb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzb_ (-)
  enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
  nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia