PDB entry 1pz5

View 1pz5 on RCSB PDB site
Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site
Class: immune system
Keywords: Antibody-antigen structure, peptide-carbohydrate mimicry, vaccine design, IMMUNE SYSTEM
Deposited on 2003-07-09, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light chain of Fab (SYA/J6)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PZ5 (0-214)
    Domains in SCOPe 2.08: d1pz5a1, d1pz5a2
  • Chain 'B':
    Compound: Heavy chain of Fab (SYA/J6)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PZ5 (0-219)
    Domains in SCOPe 2.08: d1pz5b1, d1pz5b2
  • Chain 'C':
    Compound: Octapeptide (MDWNMHAA)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1PZ5 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pz5A (A:)
    dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pz5B (B:)
    evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss
    atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
    fyslsslvtvpsstwpsqtvicnvahpaskvdlikeisgp
    

  • Chain 'C':
    No sequence available.