PDB entry 1pz2

View 1pz2 on RCSB PDB site
Description: Crystal structure of a transient covalent reaction intermediate of a family 51 alpha-L-arabinofuranosidase
Class: hydrolase
Keywords: beta-alpha8-barrel
Deposited on 2003-07-09, released 2003-10-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-l-arabinofuranosidase
    Species: Bacillus stearothermophilus
    Gene: ABFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XBQ3
      • engineered (174)
    Domains in SCOP 1.73: d1pz2a1, d1pz2a2
  • Chain 'B':
    Compound: alpha-l-arabinofuranosidase
    Species: Bacillus stearothermophilus
    Gene: ABFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XBQ3
      • engineered (174)
    Domains in SCOP 1.73: d1pz2b1, d1pz2b2
  • Heterogens: AHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pz2A (A:)
    matkkatmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielv
    kelqvpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvg
    aevnmavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpw
    qighktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdy
    islhqyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyh
    sneadkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapim
    tekngpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekee
    vtifavnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaql
    sdrkvsatlpklswnvirlgkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz2A (A:)
    katmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelq
    vpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevn
    mavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqigh
    ktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislh
    qyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsnea
    dkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekn
    gpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekeevtif
    avnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrk
    vsatlpklswnvirlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pz2B (B:)
    matkkatmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielv
    kelqvpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvg
    aevnmavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpw
    qighktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdy
    islhqyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyh
    sneadkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapim
    tekngpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekee
    vtifavnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaql
    sdrkvsatlpklswnvirlgkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz2B (B:)
    katmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelq
    vpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevn
    mavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqigh
    ktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislh
    qyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsnea
    dkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekn
    gpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekeevtif
    avnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrk
    vsatlpklswnvirlgk