PDB entry 1pyb

View 1pyb on RCSB PDB site
Description: crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
Deposited on 2003-07-08, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pyba_
  • Chain 'B':
    Domains in SCOP 1.67: d1pybb_
  • Chain 'C':
    Domains in SCOP 1.67: d1pybc_
  • Chain 'D':
    Domains in SCOP 1.67: d1pybd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pybA (A:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybA (A:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pybB (B:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybB (B:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pybC (C:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybC (C:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pybD (D:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybD (D:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls