PDB entry 1py9

View 1py9 on RCSB PDB site
Description: The crystal structure of an autoantigen in multiple sclerosis
Class: immune system
Keywords: myelin sheath, multiple sclerosis, receptor, immunoglobulin, anti-parallel dimer, IMMUNE SYSTEM
Deposited on 2003-07-08, released 2003-09-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myelin-oligodendrocyte glycoprotein
    Species: Mus musculus [TaxId:10090]
    Gene: mog
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1py9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1py9A (A:)
    qfrvigpgypiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdaeq
    apeyrgrtellketisegkvtlriqnvrfsdeggytcffrdhsyqeeaamelkved