PDB entry 1py5

View 1py5 on RCSB PDB site
Description: Crystal Structure of TGF-beta receptor I kinase with inhibitor
Class: transferase
Keywords: TGF-beta, receptor I, kinase, TRANSFERASE
Deposited on 2003-07-08, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.258
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tgf-beta receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1py5a_
  • Heterogens: SO4, PY1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1py5A (A:)
    ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
    ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
    ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
    avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
    csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
    wyangaarltalrikktlsqlsqqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py5A (A:)
    tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
    lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
    ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
    apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
    emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
    g