PDB entry 1py4

View 1py4 on RCSB PDB site
Description: Beta2 microglobulin mutant H31Y displays hints for amyloid formations
Class: signaling protein
Keywords: amyloid, Dialysis related amyloidosis, C-type immunoglobulin, protein mutant, SIGNALING PROTEIN
Deposited on 2003-07-08, released 2004-05-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.241
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating met (0)
      • engineered (31)
    Domains in SCOPe 2.02: d1py4a_
  • Chain 'B':
    Compound: Beta-2-microglobulin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • engineered (31)
    Domains in SCOPe 2.02: d1py4b_
  • Chain 'C':
    Compound: Beta-2-microglobulin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769
      • engineered (31)
    Domains in SCOPe 2.02: d1py4c_
  • Chain 'D':
    Compound: Beta-2-microglobulin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • engineered (31)
    Domains in SCOPe 2.02: d1py4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1py4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1py4B (B:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4B (B:)
    iqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1py4C (C:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4C (C:)
    qrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskdws
    fyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1py4D (D:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4D (D:)
    iqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr