PDB entry 1pxw

View 1pxw on RCSB PDB site
Description: Crystal structure of L7Ae sRNP core protein from Pyrococcus abyssii
Class: ribosome
Keywords: ribosome
Deposited on 2003-07-07, released 2004-01-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.227
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LSU ribosomal protein L7AE
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pxwa_
  • Chain 'B':
    Compound: LSU ribosomal protein L7AE
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pxwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxwA (A:)
    megwmmakpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiae
    dvdpeeivahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeia
    mkvrelmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pxwB (B:)
    megwmmakpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiae
    dvdpeeivahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeia
    mkvrelmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pxwB (B:)
    psyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeiv
    ahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk