PDB entry 1pxf

View 1pxf on RCSB PDB site
Description: Crystal Structure of Trbp111: a Structure Specific tRNA Binding Protein
Deposited on 2003-07-03, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.149
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1pxfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxfA (A:)
    metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
    ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvva