PDB entry 1pvd

View 1pvd on RCSB PDB site
Description: crystal structure of the thiamin diphosphate dependent enzyme pyruvate decarboxylase from the yeast saccharomyces cerevisiae at 2.3 angstroms resolution
Class: lyase (carbon-carbon)
Keywords: lyase (carbon-carbon)
Deposited on 1995-04-20, released 1995-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06169 (0-554)
      • conflict (53)
      • conflict (141)
      • conflict (204)
      • conflict (206)
      • conflict (536)
      • conflict (549)
    Domains in SCOPe 2.08: d1pvda1, d1pvda2, d1pvda3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06169 (0-554)
      • conflict (53)
      • conflict (141)
      • conflict (204)
      • conflict (206)
      • conflict (536)
      • conflict (549)
    Domains in SCOPe 2.08: d1pvdb1, d1pvdb2, d1pvdb3
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvdA (A:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
    ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
    qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
    afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
    ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavpa
    stplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttga
    tlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytieklih
    gpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieimlp
    vfdapqnlvkqaklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvdA (A:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
    anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmsl
    kpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpafvtpmgk
    gsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhsdhmkirna
    tfpgvqmkfvlqklltniadaakgykpvavpartpanaavpastplkqewmwnqlgnflq
    egdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvi
    lfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhlsll
    ptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlvkqaklt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pvdB (B:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
    ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
    qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
    afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
    ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavpa
    stplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttga
    tlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytieklih
    gpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieimlp
    vfdapqnlvkqaklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvdB (B:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
    anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmsl
    kpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpafvtpmgk
    gsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhsdhmkirna
    tfpgvqmkfvlqklltniadaakgykpvavpartpanaavpastplkqewmwnqlgnflq
    egdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvi
    lfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhlsll
    ptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlvkqaklt