PDB entry 1pvb

View 1pvb on RCSB PDB site
Description: x-ray structure of a new crystal form of pike 4.10 parvalbumin
Deposited on 1995-01-05, released 1995-02-27
The last revision prior to the SCOP 1.61 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 1.75 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1pvb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pvb_ (-)
  sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
  elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika