PDB entry 1pv9

View 1pv9 on RCSB PDB site
Description: Prolidase from Pyrococcus furiosus
Class: hydrolase
Keywords: prolidase, peptidase, HYDROLASE
Deposited on 2003-06-27, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.246
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xaa-Pro Dipeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PEPQ OR PF1343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pv9a1, d1pv9a2
  • Chain 'B':
    Compound: Xaa-Pro Dipeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PEPQ OR PF1343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pv9b1, d1pv9b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pv9A (A:)
    mkerleklvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyem
    akeesklpvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikd
    lriiktkeeieiiekaceiadkavmaaieeitegkrerevaakveylmkmngaekpafdt
    iiasghrsalphgvasdkriergdlvvidlgalynhynsditrtivvgspnekqreiyei
    vleaqkraveaakpgmtakeldsiareiikeygygdyfihslghgvgleihewprisqyd
    etvlkegmvitiepgiyipklggvriedtvlitengakrltkterell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv9A (A:)
    lvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemakeeskl
    pvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksvkefkkiddvikdlriiktke
    eieiiekaceiadkavmaaieeitegkrerevaakveylmkmngaekpafdtiiasghrs
    alphgvasdkriergdlvvidlgalynhynsditrtivvgspnekqreiyeivleaqkra
    veaakpgmtakeldsiareiikeygygdyfihslghgvgleihewprisqydetvlkegm
    vitiepgiyipklggvriedtvlitengakrltkter
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pv9B (B:)
    mkerleklvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyem
    akeesklpvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikd
    lriiktkeeieiiekaceiadkavmaaieeitegkrerevaakveylmkmngaekpafdt
    iiasghrsalphgvasdkriergdlvvidlgalynhynsditrtivvgspnekqreiyei
    vleaqkraveaakpgmtakeldsiareiikeygygdyfihslghgvgleihewprisqyd
    etvlkegmvitiepgiyipklggvriedtvlitengakrltkterell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv9B (B:)
    rleklvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemake
    esklpvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikdlri
    iktkeeieiiekaceiadkavmaaieeitegkrerevaakveylmkmngaekpafdtiia
    sghrsalphgvasdkriergdlvvidlgalynhynsditrtivaqkraveaakpgmtake
    ldsiareiikeygygyfihslghgvgleihewpriydetvlkegmvitiepgiyggvrie
    dtvlitengakrltkter