PDB entry 1pui

View 1pui on RCSB PDB site
Description: Structure of EngB GTPase
Class: cell cycle, ligand binding protein
Keywords: STRUCTURAL GENOMICS, NYSGXRC T16, GTPASE, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, CELL CYCLE, LIGAND BINDING PROTEIN
Deposited on 2003-06-24, released 2003-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTP-binding protein engB
    Species: Escherichia coli [TaxId:562]
    Gene: ENGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1puia_
  • Chain 'B':
    Compound: Probable GTP-binding protein engB
    Species: Escherichia coli [TaxId:562]
    Gene: ENGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1puib_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1puiA (A:)
    mtnlnyqqthfvmsapdirhlpsdtgievafagrsnagkssalntltnqkslartsktpg
    rtqlinlfevadgkrlvdlpgygyaevpeemkrkwqralgeylekrqslqglvvlmdirh
    plkdldqqmiewavdsniavlvlltkadklasgarkaqlnmvreavlafngdvqvetfss
    lkkqgvdklrqkldtwfsemqpveetqdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1puiA (A:)
    fvmsapdirhlpsdtgievafagrsnagkssalntltnqqlinlfevadgkrlvdlpgyg
    emkrkwqralgeylekrqslqglvvlmdirhplkdldqqmiewavdsniavlvlltkadk
    lasgarkaqlnmvreavlafngdvqvetfsslkkqgvdklrqkldtwfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1puiB (B:)
    mtnlnyqqthfvmsapdirhlpsdtgievafagrsnagkssalntltnqkslartsktpg
    rtqlinlfevadgkrlvdlpgygyaevpeemkrkwqralgeylekrqslqglvvlmdirh
    plkdldqqmiewavdsniavlvlltkadklasgarkaqlnmvreavlafngdvqvetfss
    lkkqgvdklrqkldtwfsemqpveetqdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1puiB (B:)
    vmsapdirhlpsdtgievafagrsnagkssalntltnqlinlfevadgkrlvdlpgyrkw
    qralgeylekrqslqglvvlmdirhplkdldqqmiewavdsniavlvlltkadklasgar
    kaqlnmvreavlafngdvqvetfsslkkqgvdklrqkldtwfse