PDB entry 1pui

View 1pui on RCSB PDB site
Description: Structure of EngB GTPase
Deposited on 2003-06-24, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1puia_
  • Chain 'B':
    Domains in SCOP 1.65: d1puib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1puiA (A:)
    mtnlnyqqthfvmsapdirhlpsdtgievafagrsnagkssalntltnqkslartsktpg
    rtqlinlfevadgkrlvdlpgygyaevpeemkrkwqralgeylekrqslqglvvlmdirh
    plkdldqqmiewavdsniavlvlltkadklasgarkaqlnmvreavlafngdvqvetfss
    lkkqgvdklrqkldtwfsemqpveetqdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1puiA (A:)
    fvmsapdirhlpsdtgievafagrsnagkssalntltnqqlinlfevadgkrlvdlpgyg
    emkrkwqralgeylekrqslqglvvlmdirhplkdldqqmiewavdsniavlvlltkadk
    lasgarkaqlnmvreavlafngdvqvetfsslkkqgvdklrqkldtwfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1puiB (B:)
    mtnlnyqqthfvmsapdirhlpsdtgievafagrsnagkssalntltnqkslartsktpg
    rtqlinlfevadgkrlvdlpgygyaevpeemkrkwqralgeylekrqslqglvvlmdirh
    plkdldqqmiewavdsniavlvlltkadklasgarkaqlnmvreavlafngdvqvetfss
    lkkqgvdklrqkldtwfsemqpveetqdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1puiB (B:)
    vmsapdirhlpsdtgievafagrsnagkssalntltnqlinlfevadgkrlvdlpgyrkw
    qralgeylekrqslqglvvlmdirhplkdldqqmiewavdsniavlvlltkadklasgar
    kaqlnmvreavlafngdvqvetfsslkkqgvdklrqkldtwfse