PDB entry 1puc

View 1puc on RCSB PDB site
Description: p13suc1 in a strand-exchanged dimer
Class: binding protein
Keywords: cell cycle, domain swapping, strand-exchanged dimer, binding protein
Deposited on 1995-12-08, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p13suc1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1puca_
  • Heterogens: CPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pucA (A:)
    sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
    tlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pucA (A:)
    sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
    tlrilqeeewrglgitqslgwemyevhvpephillfkrekd