PDB entry 1ptv

View 1ptv on RCSB PDB site
Description: crystal structure of protein tyrosine phosphatase 1b complexed with phosphotyrosine
Class: complex (hydrolase/peptide)
Keywords: hydrolase, acetylation, phosphorylation, peptide, complex (hydrolase/peptide) complex
Deposited on 1995-04-21, released 1996-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase 1b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031
      • conflict (150)
      • engineered (214)
      • conflict (251)
    Domains in SCOPe 2.04: d1ptva_
  • Heterogens: PTR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ptvA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkd
    pssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptvA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkdp
    ssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed