PDB entry 1pst

View 1pst on RCSB PDB site
Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides
Class: photosynthetic reaction center
Keywords: photosynthetic reaction center
Deposited on 1993-12-13, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1psth1, d1psth2
  • Chain 'L':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pstl_
  • Chain 'M':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02953 (0-295)
      • conflict (196)
    Domains in SCOPe 2.06: d1pstm_
  • Heterogens: FE, BCL, BPH, U10, CRT

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pstH (H:)
    laslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgrg
    tltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnki
    kpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrll
    pmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pstL (L:)
    ferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwnpqli
    svyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfafafa
    ilayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisffftna
    lalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsavffs
    alcmiitgtiwfdqwvdwwqwwvklp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pstM (M:)
    ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
    wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
    vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
    tnnfslvhgnlfynpflglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
    eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh