PDB entry 1pss

View 1pss on RCSB PDB site
Description:
Deposited on 1993-12-13, released 1994-04-30
The last revision prior to the SCOP 1.63 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1pssh1, d1pssh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1pssl_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1pssm_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pssH (H:)
    laslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgrg
    tltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnki
    kpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrll
    pmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pssL (L:)
    ferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwnpqli
    svyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfafafa
    ilayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisffftna
    lalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsavffs
    alcmiitgtiwfdqwvdwwqwwvklp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pssM (M:)
    ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
    wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
    vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
    tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
    eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh