PDB entry 1psr
View 1psr on RCSB PDB site
Description: human psoriasin (s100a7)
Class: ef-hand protein
Keywords: ef-hand protein, mad phasing, psoriasis, s100 protein family
Deposited on
1997-11-27, released
1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-06, with a file datestamp of
2011-07-01.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.109
AEROSPACI score: 1.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: psoriasin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1psra_ - Chain 'B':
Compound: psoriasin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1psrb_ - Heterogens: HO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1psrA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1psrB (B:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq