PDB entry 1psk

View 1psk on RCSB PDB site
Description: the crystal structure of an fab fragment that binds to the melanoma-associated gd2 ganglioside
Deposited on 1997-03-03, released 1997-09-04
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pskH (H:)
    evqlqqsgpelvkpgasvkiscktsgytftkytmhwvkqshgkslewigdinpnnggtny
    nqkfkgtatltvhkssttaymelrsltsedsavyyctsksfdywgqgttltvssakttap
    svyplapvcgdttgsavtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pskH (H:)
    evqlqqsgpelvkpgasvkiscktsgytftkytmhwvkqshgkslewigdinpnnggtny
    nqkfkgtatltvhkssttaymelrsltsedsavyyctsksfdywgqgttltvssakttap
    svyplapvavtlgclvkgyfpepvtltwnssgvhtfpavlqsdlytlsssvtvtsstwps
    qsitcnvahpasstkvdk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pskL (L:)
    qivltqspaimsaspgekvtitcsasssvsnihwfqqkpgtfpklwiyststlasgvpgr
    fsgsgsgtsysltisrmgaedaatyycqqrsgypftfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec