PDB entry 1prz

View 1prz on RCSB PDB site
Description: Crystal structure of pseudouridine synthase RluD catalytic module
Class: lyase
Keywords: Crystal structure, Pseudouridine synthase, RluD, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics
Deposited on 2003-06-20, released 2003-11-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal large subunit pseudouridine synthase D
    Species: Escherichia coli
    Gene: RLUD or SFHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X9F0 (0-251)
      • modified residue (71)
      • modified residue (104)
      • modified residue (124)
      • modified residue (129)
      • modified residue (140)
      • modified residue (165)
      • modified residue (208)
      • modified residue (220)
      • modified residue (230)
      • modified residue (237)
    Domains in SCOP 1.75: d1prza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1przA (A:)
arfepqdipldivyedediivinkprdlvvhpgagnpdgtvlnallhyyppiadvpragi
vhrldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhpt
krthmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyg
grprppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmra
dfeehkdevdwl