PDB entry 1pru

View 1pru on RCSB PDB site
Description: purine repressor DNA-binding domain DNA binding
Class: DNA-binding protein
Keywords: purine repressor
Deposited on 1995-05-08, released 1996-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine repressor
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1prua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pruA (A:)
    matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv