PDB entry 1prt

View 1prt on RCSB PDB site
Description: the crystal structure of pertussis toxin
Deposited on 1993-11-22, released 1995-01-26
The last revision prior to the SCOP 1.57 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1prtA (A:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1prtA (A:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtB (B:)
    givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl
    ggeyggvikdgtpggafdlkttfcimttrntgqpatdhyysnvtatrllsstnsrlcavf
    vrsgqpvigactspydgkywsmysrlrkmlyliyvagisvrvhvskeeqyydyedatfet
    yaltgisicnpgsslc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtC (C:)
    givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
    gqayggiikdappgagfiyretfcittiyktgqpaadhyyskvtatrllastnsrlcavf
    vrdgqsvigacaspyegryrdmydalrrllymiymsglavrvhvskeeqyydyedatfqt
    yaltgislcnpaasic
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtD (D:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtE (E:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtF (F:)
    lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
    sayalksrialtvedspypgtpgdllelqicplngyce
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1prtG (G:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1prtG (G:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtH (H:)
    givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl
    ggeyggvikdgtpggafdlkttfcimttrntgqpatdhyysnvtatrllsstnsrlcavf
    vrsgqpvigactspydgkywsmysrlrkmlyliyvagisvrvhvskeeqyydyedatfet
    yaltgisicnpgsslc
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtI (I:)
    givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
    gqayggiikdappgagfiyretfcittiyktgqpaadhyyskvtatrllastnsrlcavf
    vrdgqsvigacaspyegryrdmydalrrllymiymsglavrvhvskeeqyydyedatfqt
    yaltgislcnpaasic
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtJ (J:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtK (K:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prtL (L:)
    lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
    sayalksrialtvedspypgtpgdllelqicplngyce