PDB entry 1prq

View 1prq on RCSB PDB site
Description: acanthamoeba castellanii profilin ia
Deposited on 1997-08-18, released 1997-12-24
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-15, with a file datestamp of 2001-02-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.141
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1prq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1prq_ (-)
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgqtlasafnnadpirasgf
dlagvhyvtlraddrsiygkkgsagvitvktsksilvgvynekiqpgtaanvvekladyl
igqgf