PDB entry 1prg

View 1prg on RCSB PDB site
Description: ligand binding domain of the human peroxisome proliferator activated receptor gamma
Deposited on 1998-07-02, released 1999-06-22
The last revision prior to the SCOP 1.61 freeze date was dated 2000-01-13, with a file datestamp of 2000-01-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1prga_
  • Chain 'B':
    Domains in SCOP 1.61: d1prgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prgA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prgB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl