PDB entry 1pq9

View 1pq9 on RCSB PDB site
Description: human lxr beta hormone receptor complexed with t0901317 complex
Class: transcription regulation
Keywords: LXRB+T0901317 SPLIT, transcription regulation
Deposited on 2003-06-18, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2 OR LXRB OR UNR OR NER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq9a_
  • Chain 'B':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2 OR LXRB OR UNR OR NER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq9b_
  • Chain 'C':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2 OR LXRB OR UNR OR NER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq9c_
  • Chain 'D':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2 OR LXRB OR UNR OR NER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq9d_
  • Heterogens: BNS, 44B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pq9A (A:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq9A (A:)
    ltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwprdarqqrfahftelaiisvqeivdfa
    kqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglq
    vefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsy
    trikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pq9B (B:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq9B (B:)
    qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadprdarqqrfahftelaiisvq
    eivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddf
    hraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyv
    eallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pq9C (C:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq9C (C:)
    ltaaqelmiqqlvaaqlqcnkrsfkvtpwplqsrdarqqrfahftelaiisvqeivdfak
    qvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqv
    efinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsyt
    rikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pq9D (D:)
    gshmgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecit
    flkdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkk
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq9D (D:)
    ltaaqelmiqqlvaaqlqcnkrsvtpwsrdarqqrfahftelaiisvqeivdfakqvpgf
    lqlgredqiallkastieimlletarrynhetecitfftyskddfhraglqvefinpife
    fsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytrikrpqdq
    lrfprmlmklvslrtlssvhseqvfalrklppllseiwd