PDB entry 1ppj

View 1ppj on RCSB PDB site
Description: Bovine cytochrome bc1 complex with stigmatellin and antimycin
Class: oxidoreductase
Keywords: cytochrome bc1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome b, cytochrome c1, complex III, mitochondrial processing protease, mpp ubiquinone, oxidoreductase, redox enzyme, respiratory chain, stigmatellin, antimycin
Deposited on 2003-06-16, released 2004-07-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppja1, d1ppja2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjb1, d1ppjb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjc1, d1ppjc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjd1, d1ppjd2
  • Chain 'E':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppje1, d1ppje2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjf_
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjg_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjh_
  • Chain 'I':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppji_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjj_
  • Chain 'N':
    Compound: Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjn1, d1ppjn2
  • Chain 'O':
    Compound: Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjo1, d1ppjo2
  • Chain 'P':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjp1, d1ppjp2
  • Chain 'Q':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjq1, d1ppjq2
  • Chain 'R':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjr1, d1ppjr2
  • Chain 'S':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjs_
  • Chain 'T':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjt_
  • Chain 'U':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppju_
  • Chain 'V':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjv_
  • Chain 'W':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ppjw_
  • Heterogens: BHG, AZI, PO4, HEM, HEC, FES, SMA, CDL, PEE, ANY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ppjA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjA (A:)
    atyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfveh
    lafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqncs
    ledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsrad
    lteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsqi
    chredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaatn
    klcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknll
    rnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcpa
    vagfgpieqlpdynrirsgmfw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ppjB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjB (B:)
    evpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassl
    ttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrw
    evaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyv
    qnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvha
    alvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnas
    ysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvess
    egfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpf
    idel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ppjC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjC (C:)
    nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
    ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
    wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
    vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
    nytpanplntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrs
    mmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtien
    kllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ppjF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjF (F:)
    wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
    qqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ppjG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ppjH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ppjI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlklsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjI (I:)
    aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ppjJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjJ (J:)
    fferafdqgadaiyehinegklwkhikhkyenk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ppjN (N:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjN (N:)
    atyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfveh
    lafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqncs
    ledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsrad
    lteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsqi
    chredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaatn
    klcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknll
    rnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcpa
    vagfgpieqlpdynrirsgmfw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ppjO (O:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjO (O:)
    evpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassl
    ttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrw
    evaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyv
    qnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvha
    alvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnas
    ysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvess
    egfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpf
    idel
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ppjP (P:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjP (P:)
    nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
    ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
    wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
    vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
    nytpanplntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrs
    mmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtien
    kllkw
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjQ (Q:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjR (R:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1ppjS (S:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjS (S:)
    wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
    qqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1ppjT (T:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjT (T:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1ppjU (U:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjU (U:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnslk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1ppjV (V:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlklsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjV (V:)
    aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjW (W:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk