PDB entry 1pp9

View 1pp9 on RCSB PDB site
Description: Bovine cytochrome bc1 complex with stigmatellin bound
Class: oxidoreductase
Keywords: cytochrome bc1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome b, cytochrome c1, complex III, mitochondrial processing protease, mpp ubiquinone, oxidoreductase, redox enzyme, respiratory chain, stigmatellin
Deposited on 2003-06-16, released 2004-07-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.25
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9a1, d1pp9a2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9b1, d1pp9b2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9c1, d1pp9c2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9d1, d1pp9d2
  • Chain 'E':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9e1, d1pp9e2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9f_
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9g_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9h_
  • Chain 'I':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9i_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9j_
  • Chain 'N':
    Compound: Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9n1, d1pp9n2
  • Chain 'O':
    Compound: Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9o1, d1pp9o2
  • Chain 'P':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9p1, d1pp9p2
  • Chain 'Q':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9q1, d1pp9q2
  • Chain 'R':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9r1, d1pp9r2
  • Chain 'S':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9s_
  • Chain 'T':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9t_
  • Chain 'U':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9u_
  • Chain 'V':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9v_
  • Chain 'W':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pp9w_
  • Heterogens: BHG, PO4, AZI, HEM, HEC, FES, SMA, UQ, CDL, PEE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pp9A (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9A (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pp9B (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9B (B:)
    evpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassl
    ttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrw
    evaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyv
    qnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvha
    alvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnas
    ysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvess
    egfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpf
    idel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pp9C (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9C (C:)
    nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
    ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
    wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
    vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
    nytpanplntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrs
    mmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtien
    kllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp9D (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp9E (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pp9F (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9F (F:)
    wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
    qqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pp9G (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9G (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pp9H (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9H (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1pp9I (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9I (I:)
    aavpatsespvsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp9J (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1pp9N (N:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9N (N:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1pp9O (O:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9O (O:)
    evpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassl
    ttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrw
    evaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyv
    qnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvha
    alvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnas
    ysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvess
    egfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpf
    idel
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1pp9P (P:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9P (P:)
    lmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthi
    crdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafm
    gyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfii
    maiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdl
    lgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsililalipllht
    skqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmpta
    gtienkllkw
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp9Q (Q:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp9R (R:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1pp9S (S:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9S (S:)
    wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
    qqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1pp9T (T:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9T (T:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1pp9U (U:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9U (U:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnslk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1pp9V (V:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp9V (V:)
    aavpatsespvsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp9W (W:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk