PDB entry 1pow

View 1pow on RCSB PDB site
Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum
Class: oxidoreductase(oxygen as acceptor)
Keywords: oxidoreductase(oxygen as acceptor)
Deposited on 1993-11-09, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1powa1, d1powa2, d1powa3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1powb1, d1powb2, d1powb3
  • Heterogens: MG, TPP, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1powA (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1powB (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd