PDB entry 1pon

View 1pon on RCSB PDB site
Description: site III-site IV troponin c heterodimer, nmr
Class: calcium-binding protein
Keywords: ef-hand, muscle protein, calcium-binding protein
Deposited on 1996-04-02, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02588 (0-33)
      • engineered (8)
      • engineered (19)
    Domains in SCOPe 2.06: d1pon.1
  • Chain 'B':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pon.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ponA (A:)
    kseeelanafrifdknadgyidieelgeilratg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ponB (B:)
    vteediedlmkdsdknndgridfdeflkmmegvq