PDB entry 1poi

View 1poi on RCSB PDB site
Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution
Deposited on 1997-01-24, released 1998-03-18
The last revision prior to the SCOP 1.67 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1poia_
  • Chain 'B':
    Domains in SCOP 1.67: d1poib_
  • Chain 'C':
    Domains in SCOP 1.67: d1poic_
  • Chain 'D':
    Domains in SCOP 1.67: d1poid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poiA (A:)
    skvmtlkdaiakyvhsgdhialggfttdrkpyaavfeilrqgitdltglggaaggdwdml
    igngrvkayincytansgvtnvsrrfrkwfeagkltmedysqdviymmwhaaalglpflp
    vtlmqgsgltdewgiskevrktldkvpddkfkyidnpfkpgekvvavpvpqvdvaiihaq
    qaspdgtvriwggkfqdvdiaeaakytivtceeiisdeeirrdptkndipgmcvdavvla
    pygahpsqcyglydydnpflkvydkvsktqedfdafckewvfdlkdhdeylnklgatrli
    nlkvvpglgyhidmtke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poiB (B:)
    dytnytnkemqavtiakqikngqvvtvgtglpligasvakrvyapdchiivesglmdcsp
    vevprsvgdlrfmahcgciwpnvrfvgfeineylhkanrliafiggaqidpygnvnstsi
    gdyhhpktrftgsggangiatysntiimmqhekrrfmnkidyvtspgwidgpggrerlgl
    pgdvgpqlvvtdkgilkfdektkrmylaayyptsspedvlentgfdldvskaveleapdp
    aviklireeidpgqafiqvp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poiC (C:)
    skvmtlkdaiakyvhsgdhialggfttdrkpyaavfeilrqgitdltglggaaggdwdml
    igngrvkayincytansgvtnvsrrfrkwfeagkltmedysqdviymmwhaaalglpflp
    vtlmqgsgltdewgiskevrktldkvpddkfkyidnpfkpgekvvavpvpqvdvaiihaq
    qaspdgtvriwggkfqdvdiaeaakytivtceeiisdeeirrdptkndipgmcvdavvla
    pygahpsqcyglydydnpflkvydkvsktqedfdafckewvfdlkdhdeylnklgatrli
    nlkvvpglgyhidmtke
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poiD (D:)
    dytnytnkemqavtiakqikngqvvtvgtglpligasvakrvyapdchiivesglmdcsp
    vevprsvgdlrfmahcgciwpnvrfvgfeineylhkanrliafiggaqidpygnvnstsi
    gdyhhpktrftgsggangiatysntiimmqhekrrfmnkidyvtspgwidgpggrerlgl
    pgdvgpqlvvtdkgilkfdektkrmylaayyptsspedvlentgfdldvskaveleapdp
    aviklireeidpgqafiqvp