PDB entry 1pne

View 1pne on RCSB PDB site
Description: crystallization and structure determination of bovine profilin at 2.0 angstroms resolution
Deposited on 1995-05-05, released 1995-07-31
The last revision prior to the SCOP 1.69 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1pne__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pne_ (-)
  agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
  ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
  gminkkcyemashlrrsqy