PDB entry 1pn9

View 1pn9 on RCSB PDB site
Description:
Deposited on 2003-06-12, released 2003-12-09
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pn9a1, d1pn9a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1pn9b1, d1pn9b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pn9A (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltdlmkgehmkpeflklnpqhciptlvdngf
    alwesraiqiylaekygkddklypkdpqkravvnqrlyfdmgtlyqrfadyhypqifakq
    panpenekkmkdavgflntflegqeyaagndltiadlslaatiatyevagfdfapypnva
    awfarckanapgyalnqagadefkakfls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pn9B (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltdlmkgehmkpeflklnpqhciptlvdngf
    alwesraiqiylaekygkddklypkdpqkravvnqrlyfdmgtlyqrfadyhypqifakq
    panpenekkmkdavgflntflegqeyaagndltiadlslaatiatyevagfdfapypnva
    awfarckanapgyalnqagadefkakfls