PDB entry 1pn7

View 1pn7 on RCSB PDB site
Description: Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome
Class: RNA binding protein/RNA
Keywords: ribosomal protein, tRNA binding protein, tRNA, RNA binding protein/RNA COMPLEX
Deposited on 2003-06-12, released 2003-07-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: EM
Resolution: 10.8 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: P-tRNA
  • Chain 'L':
    Compound: 50S ribosomal protein L11
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pn7l_
  • Chain 'O':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pn7o_

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pn7L (L:)
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pn7O (O:)
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea