PDB entry 1pn7

View 1pn7 on RCSB PDB site
Description: Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome
Deposited on 2003-06-12, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.65: d1pn7c_
  • Chain 'L':
    Domains in SCOP 1.65: d1pn7l_
  • Chain 'O':
    Domains in SCOP 1.65: d1pn7o_

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pn7L (L:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pn7O (O:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea