PDB entry 1pmu

View 1pmu on RCSB PDB site
Description: The crystal structure of JNK3 in complex with a phenantroline inhibitor
Class: transferase
Keywords: MAP kinase, apoptosis, inhibition, selectivity
Deposited on 2003-06-11, released 2003-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MK10_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pmua_
  • Heterogens: CL, 9HP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmuA (A:)
    maskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsr
    pfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvie
    qlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardlls
    kmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliyke
    vmns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmuA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartpyvvtryyrap
    evilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqp
    tvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvdd
    alqhpyinvwydpaeveapppqderehtieewkeliykevmn