PDB entry 1pmt

View 1pmt on RCSB PDB site
Description: glutathione transferase from proteus mirabilis
Deposited on 1998-03-23, released 1999-04-20
The last revision prior to the SCOP 1.61 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmt_ (-)
    mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
    diltegvaivqyladlkpdrnliappkaleryhqiewlnflasevhkgysplfssdtpes
    ylpvvknklkskfvyindvlskqkcvcgdhftvadaylftlsqwaphvaldltdlshlqd
    ylariaqrpnvhsalvtegli