PDB entry 1pmq

View 1pmq on RCSB PDB site
Description: The structure of JNK3 in complex with an imidazole-pyrimidine inhibitor
Class: transferase
Keywords: MAP kinase, apoptosis, inhibition
Deposited on 2003-06-11, released 2003-09-09
Made obsolete by 4z9l on 2015-05-06

The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-09, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MK10_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pmqa_
  • Heterogens: ANP, 880, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmqA (A:)
    maskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsr
    pfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvie
    qlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardlls
    kmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliyke
    vmns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmqA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglarsfmmtpyvvtry
    yrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmk
    klqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakri
    svddalqhpyinvwydpaeveapppqqlderehtieewkeliykevmn