PDB entry 1pme

View 1pme on RCSB PDB site
Description: structure of penta mutant human erk2 map kinase complexed with a specific inhibitor of human p38 map kinase
Deposited on 1998-06-08, released 1999-06-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pme__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1pme_ (-)
    gqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlreikil
    lrfrheniigindiiraptieqmkdvylvthlmgadlykllktqhlsndhicyflyqilr
    glkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyra
    peimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnci
    inlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleq
    yydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pme_ (-)
    gqvfdvgprytnlsyigygmvcsaydnvnkvrvaikkispfehqtycqrtlreikillrf
    rheniigindiiraptieqmkdvylvthlmgadlykllktqhlsndhicyflyqilrglk
    yihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyrapei
    mlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinl
    karnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyyd
    psdepiaeapflpkeklkelifeetarfqpgyrs